PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_017459-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 290aa    MW: 32072.6 Da    PI: 6.8603
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_017459-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.43.4e-3347103360
    ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                      rY+eClkNhA+s+GghavDGCgEfm++ geegt +alkCaAC+CHRnFHR+e+e e
  NNU_017459-RA  47 VSRYRECLKNHAVSIGGHAVDGCGEFMAA-GEEGTLDALKCAACNCHRNFHRKETEGE 103
                    579*************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-2448101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.6E-3049100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.8E-304999IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.6995099IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-23148211IPR009057Homeodomain-like
SuperFamilySSF466891.13E-12149211IPR009057Homeodomain-like
TIGRFAMsTIGR015652.4E-18162211IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEFDDHEEQD EEMGMPVSAS YESLGNSSRA KMAGAGGDGG SSGRKTVSRY RECLKNHAVS  60
IGGHAVDGCG EFMAAGEEGT LDALKCAACN CHRNFHRKET EGEVYHHQFS PYYRTPAGYL  120
HVAPHHRPLA LPSTSGGGGG AQSREDQEDD VSNPSGGGGS SKKRFRTKFT QEQKDKMLAF  180
AEKLGWRIQK HDEAAVQQFC TETCVKRHVL KHQHQHLLLP LLLLLLSLAT STNSFLHHCT  240
GTKDKGNLLD KEEEEQQLRV DDERRTNGMG NSFENSSIRC SLEMNLIRRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-211612111666ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272957.11e-142PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotQ6YXH52e-78ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLF6H1061e-107F6H106_VITVI; Putative uncharacterized protein
TrEMBLA5BZD71e-107A5BZD7_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g07140.t011e-106(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-63homeobox protein 22